PDB entry 3oci

View 3oci on RCSB PDB site
Description: Crystal structure of TBP (TATA box binding protein)
Class: trancription
Keywords: Trancription, Transcription Initiation
Deposited on 2010-08-10, released 2011-07-13
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-27, with a file datestamp of 2011-07-22.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.183
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: transcription initiation factor tfiid (tfiid-1)
    Species: Encephalitozoon cuniculi [TaxId:6035]
    Gene: ECU04_1440
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3ocia1, d3ocia2
  • Chain 'B':
    Compound: transcription initiation factor tfiid (tfiid-1)
    Species: Encephalitozoon cuniculi [TaxId:6035]
    Gene: ECU04_1440
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3ocib1, d3ocib2
  • Heterogens: EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ociA (A:)
    mgsshhhhhhssglvprgshmdapdisyehqetsvpnrsgiiptlqnvvatvnlsckldl
    knialrarnaeynpkrfaavimrirepkttalifasgkmvitgaksekssrmaaqryaki
    ihklgfnatfddfkiqnivsscdikfsirleglayahsnycsyepelfpgliyrmvkpki
    vllifvsgkivltgakvrddiyqafnniypvliqhrka
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ociA (A:)
    sgiiptlqnvvatvnlsckldlknialrarnaeynpkrfaavimrirepkttalifasgk
    mvitgaksekssrmaaqryakiihklgfnatfddfkiqnivsscdikfsirleglayahs
    nycsyepelfpgliyrmvkpkivllifvsgkivltgakvrddiyqafnniypvliqhrk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3ociB (B:)
    mgsshhhhhhssglvprgshmdapdisyehqetsvpnrsgiiptlqnvvatvnlsckldl
    knialrarnaeynpkrfaavimrirepkttalifasgkmvitgaksekssrmaaqryaki
    ihklgfnatfddfkiqnivsscdikfsirleglayahsnycsyepelfpgliyrmvkpki
    vllifvsgkivltgakvrddiyqafnniypvliqhrka
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ociB (B:)
    sgiiptlqnvvatvnlsckldlknialrarnaeynpkrfaavimrirepkttalifasgk
    mvitgaksekssrmaaqryakiihklgfnatfddfkiqnivsscdikfsirleglayahs
    nycsyepelfpgliyrmvkpkivllifvsgkivltgakvrddiyqafnniypvliqhrka