SCOPe 2.05: Domain d3msxb_: 3msx B:

Lineage for d3msxb_ (3msx B:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.116: GTPase activation domain, GAP [48349] (1 superfamily)
   multihelical

4. Superfamily a.116.1: GTPase activation domain, GAP [48350] (3 families)

5. Family a.116.1.0: automated matches [227202] (1 protein)
   not a true family

6. Protein automated matches [226932] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225230] (7 PDB entries)

8. Domain d3msxb_: 3msx B: [232953]
   Other proteins in same PDB: d3msxa_
   automated match to d2osaa_
   complexed with gdp, mg, mgf

Details for d3msxb_

PDB Entry: 3msx, 1.65 Å

PDB Description: crystal structure of rhoa.gdp.mgf3 in complex with gap domain of arhgap20

PDB Compounds: (B:) Rho GTPase-activating protein 20

SCOPe Domain Sequences for d3msxb_:

Sequence; same for both SEQRES and ATOM records:

>d3msxb_ a.116.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gqlfgislpnicendnlpkpvldmlfflnqkgpltkgifrqsanvkscrelkeklnsgve
vhldcesifviasvlkdflrnipgsifssdlydhwvsvmdqgndeekintvqrlldqlpr
anvvllrylfgvlhnieqhsssnqmtafnlavcvapsilwppassspeleneftkkvsll
iqflienclrif

Timeline for d3msxb_:

• d3msxb_ first appeared in SCOPe 2.03
  
• d3msxb_ appears in SCOPe 2.04
  
• d3msxb_ appears in SCOPe 2.06
  
• d3msxb_ appears in the current release, SCOPe 2.08