![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.116: GTPase activation domain, GAP [48349] (1 superfamily) multihelical |
![]() | Superfamily a.116.1: GTPase activation domain, GAP [48350] (3 families) ![]() |
![]() | Family a.116.1.0: automated matches [227202] (1 protein) not a true family |
![]() | Protein automated matches [226932] (4 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [225230] (9 PDB entries) |
![]() | Domain d3msxb_: 3msx B: [232953] Other proteins in same PDB: d3msxa_ automated match to d2osaa_ complexed with gdp, mg, mgf |
PDB Entry: 3msx (more details), 1.65 Å
SCOPe Domain Sequences for d3msxb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3msxb_ a.116.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} gqlfgislpnicendnlpkpvldmlfflnqkgpltkgifrqsanvkscrelkeklnsgve vhldcesifviasvlkdflrnipgsifssdlydhwvsvmdqgndeekintvqrlldqlpr anvvllrylfgvlhnieqhsssnqmtafnlavcvapsilwppassspeleneftkkvsll iqflienclrif
Timeline for d3msxb_: