Class b: All beta proteins [48724] (104 folds) |
Fold b.10: Viral coat and capsid proteins [49610] (1 superfamily) |
Superfamily b.10.1: Viral coat and capsid proteins [49611] (4 families) |
Family b.10.1.2: Plant virus proteins [49616] (15 proteins) |
Protein STNV coat protein [49621] (1 species) |
Species Satellite tobacco necrosis virus [TaxId:12881] [49622] (1 PDB entry) |
Domain d2stv__: 2stv - [23287] |
PDB Entry: 2stv (more details), 2.5 Å
SCOP Domain Sequences for d2stv__:
Sequence; same for both SEQRES and ATOM records: (download)
>d2stv__ b.10.1.2 (-) STNV coat protein {Satellite tobacco necrosis virus} tmravkrminthlehkrfalinsgntnatagtvqnlsngiiqgddinqrsgdqvrivshk lhvrgtaitvsqtfrfiwfrdnmnrgttptvlevlntanfmsqynpitlqqkrftilkdv tlncsltgesikdriinlpgqlvnyngatavaasngpgaifmlqigdslvglwdssyeav ytda
Timeline for d2stv__: