Lineage for d2stv__ (2stv -)
- Root: SCOP 1.57
Class b: All beta proteins [48724] (104 folds) 
Fold b.10: Viral coat and capsid proteins [49610] (1 superfamily) Superfamily b.10.1: Viral coat and capsid proteins [49611] (4 families) 
Family b.10.1.2: Plant virus proteins [49616] (15 proteins) 
Protein STNV coat protein [49621] (1 species) Species Satellite tobacco necrosis virus [TaxId:12881] [49622] (1 PDB entry) 
Domain d2stv__: 2stv - [23287]
Details for d2stv__
PDB Entry: 2stv (more details), 2.5 Å
PDB Description: the structure of satellite tobacco necrosis virus
SCOP Domain Sequences for d2stv__:
Sequence; same for both SEQRES and ATOM records: (download)
>d2stv__ b.10.1.2 (-) STNV coat protein {Satellite tobacco necrosis virus}
tmravkrminthlehkrfalinsgntnatagtvqnlsngiiqgddinqrsgdqvrivshk
lhvrgtaitvsqtfrfiwfrdnmnrgttptvlevlntanfmsqynpitlqqkrftilkdv
tlncsltgesikdriinlpgqlvnyngatavaasngpgaifmlqigdslvglwdssyeav
ytda
SCOP Domain Coordinates for d2stv__:
Click to download the PDB-style file with coordinates for d2stv__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2stv__:
- d2stv__ first appeared (with stable ids) in SCOP 1.55
- d2stv__ appears in SCOP 1.59
- d2stv__ last appears in SCOP 1.71
View in 3D