SCOP 1.59: Domain d2stv__: 2stv -

Lineage for d2stv__ (2stv -)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.10: Viral coat and capsid proteins [49610] (1 superfamily)

4. Superfamily b.10.1: Viral coat and capsid proteins [49611] (4 families)

5. Family b.10.1.2: Plant virus proteins [49616] (15 proteins)

6. Protein STNV coat protein [49621] (1 species)

7. Species Satellite tobacco necrosis virus [TaxId:12881] [49622] (1 PDB entry)

8. Domain d2stv__: 2stv - [23287]

Details for d2stv__

PDB Entry: 2stv, 2.5 Å

PDB Description: the structure of satellite tobacco necrosis virus

SCOP Domain Sequences for d2stv__:

Sequence; same for both SEQRES and ATOM records:

>d2stv__ b.10.1.2 (-) STNV coat protein {Satellite tobacco necrosis virus}
tmravkrminthlehkrfalinsgntnatagtvqnlsngiiqgddinqrsgdqvrivshk
lhvrgtaitvsqtfrfiwfrdnmnrgttptvlevlntanfmsqynpitlqqkrftilkdv
tlncsltgesikdriinlpgqlvnyngatavaasngpgaifmlqigdslvglwdssyeav
ytda

Timeline for d2stv__:

• d2stv__ first appeared (with stable ids) in SCOP 1.55
  
• d2stv__ appears in SCOP 1.57
  
• d2stv__ appears in SCOP 1.61
  
• d2stv__ last appears in SCOP 1.71