PDB entry 2stv

View 2stv on RCSB PDB site
Description: the structure of satellite tobacco necrosis virus
Deposited on 1984-06-08, released 1984-07-18
The last revision prior to the SCOP 1.57 freeze date was dated 1991-01-15, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.57: d2stv__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2stv_ (-)
    tmravkrminthlehkrfalinsgntnatagtvqnlsngiiqgddinqrsgdqvrivshk
    lhvrgtaitvsqtfrfiwfrdnmnrgttptvlevlntanfmsqynpitlqqkrftilkdv
    tlncsltgesikdriinlpgqlvnyngatavaasngpgaifmlqigdslvglwdssyeav
    ytda