![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
![]() | Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) ![]() |
![]() | Family b.47.1.1: Prokaryotic proteases [50495] (16 proteins) |
![]() | Protein automated matches [190306] (9 species) not a true protein |
![]() | Species Escherichia coli K-12 [TaxId:83333] [225952] (8 PDB entries) |
![]() | Domain d3lgwa_: 3lgw A: [232838] automated match to d3lgib_ mutant |
PDB Entry: 3lgw (more details), 2.5 Å
SCOPe Domain Sequences for d3lgwa_:
Sequence, based on SEQRES records: (download)
>d3lgwa_ b.47.1.1 (A:) automated matches {Escherichia coli K-12 [TaxId: 83333]} stdetpasynlavrraapavvnvynrglntnshnqleirtlgsgvimdqrgyiitnkhvi ndadqiivalqdgrvfeallvgsdsltdlavlkinatgglptipinarrvphigdvvlai gnpynlgqvitqgiisatgriglnptgrqnflqtdasinpgnsggalvnslgelmgintl sfdksndgetpegigfaipfqlatkimdklirdgrvi
>d3lgwa_ b.47.1.1 (A:) automated matches {Escherichia coli K-12 [TaxId: 83333]} stdetpasynlavrraapavvnvynrgleirtlgsgvimdqrgyiitnkhvindadqiiv alqdgrvfeallvgsdsltdlavlkinatgglptipinarrvphigdvvlaignpgqvit qgiisatgnflqtdasinpgnsggalvnslgelmgintlspegigfaipfqlatkimdkl irdgrvi
Timeline for d3lgwa_: