![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.116: alpha/beta knot [75216] (1 superfamily) core: 3 layers: a/b/a, parallel beta-sheet of 5 strands, order 21435; contains a deep trefoil knot |
![]() | Superfamily c.116.1: alpha/beta knot [75217] (9 families) ![]() known or predicted SAM-dependent methytransferases including the SPOUT 'sequence' superfamily all known members have dimeric structures |
![]() | Family c.116.1.0: automated matches [191557] (1 protein) not a true family |
![]() | Protein automated matches [190961] (13 species) not a true protein |
![]() | Species Anaplasma phagocytophilum [TaxId:212042] [232723] (2 PDB entries) |
![]() | Domain d3knuc_: 3knu C: [232726] automated match to d3quva_ |
PDB Entry: 3knu (more details), 2.25 Å
SCOPe Domain Sequences for d3knuc_:
Sequence, based on SEQRES records: (download)
>d3knuc_ c.116.1.0 (C:) automated matches {Anaplasma phagocytophilum [TaxId: 212042]} smifnvltifpqmfpgplgvsnlgsalkkglwtlnvfdirafannkhntvddtpygggpg mllradvlgrcidevlslhpntklmftsprgvsftqdiarqtmnfdnitllcgrfegide rvvdfyklqevsigdyvlsggelaamviidtcvrmvpgvignaeslkqesmegsleypqy trpaswkgmevpevlltgnhgeiekwrrnas
>d3knuc_ c.116.1.0 (C:) automated matches {Anaplasma phagocytophilum [TaxId: 212042]} smifnvltifpqmfpgplgvsnlgsalkkglwtlnvfdirafannkhntvddtpygggpg mllradvlgrcidevlslhpntklmftsprgvsftqdiarqtmnfdnitllcgrfegide rvvdfyklqevsigdyvlsggelaamviidtcvrmvpgvignleypqytrpaswkgmevp evlltgnhgeiekwrrnas
Timeline for d3knuc_: