Lineage for d3knuc1 (3knu C:1-210)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2921212Fold c.116: alpha/beta knot [75216] (1 superfamily)
    core: 3 layers: a/b/a, parallel beta-sheet of 5 strands, order 21435; contains a deep trefoil knot
  4. 2921213Superfamily c.116.1: alpha/beta knot [75217] (9 families) (S)
    known or predicted SAM-dependent methytransferases including the SPOUT 'sequence' superfamily
    all known members have dimeric structures
  5. 2921420Family c.116.1.0: automated matches [191557] (1 protein)
    not a true family
  6. 2921421Protein automated matches [190961] (22 species)
    not a true protein
  7. 2921427Species Anaplasma phagocytophilum [TaxId:212042] [232723] (2 PDB entries)
  8. 2921431Domain d3knuc1: 3knu C:1-210 [232726]
    Other proteins in same PDB: d3knua2, d3knub2, d3knuc2
    automated match to d3quva_

Details for d3knuc1

PDB Entry: 3knu (more details), 2.25 Å

PDB Description: crystal structure of trna (guanine-n1)-methyltransferase from anaplasma phagocytophilum
PDB Compounds: (C:) tRNA (guanine-N(1)-)-methyltransferase

SCOPe Domain Sequences for d3knuc1:

Sequence, based on SEQRES records: (download)

>d3knuc1 c.116.1.0 (C:1-210) automated matches {Anaplasma phagocytophilum [TaxId: 212042]}
mifnvltifpqmfpgplgvsnlgsalkkglwtlnvfdirafannkhntvddtpygggpgm
llradvlgrcidevlslhpntklmftsprgvsftqdiarqtmnfdnitllcgrfegider
vvdfyklqevsigdyvlsggelaamviidtcvrmvpgvignaeslkqesmegsleypqyt
rpaswkgmevpevlltgnhgeiekwrrnas

Sequence, based on observed residues (ATOM records): (download)

>d3knuc1 c.116.1.0 (C:1-210) automated matches {Anaplasma phagocytophilum [TaxId: 212042]}
mifnvltifpqmfpgplgvsnlgsalkkglwtlnvfdirafannkhntvddtpygggpgm
llradvlgrcidevlslhpntklmftsprgvsftqdiarqtmnfdnitllcgrfegider
vvdfyklqevsigdyvlsggelaamviidtcvrmvpgvignleypqytrpaswkgmevpe
vlltgnhgeiekwrrnas

SCOPe Domain Coordinates for d3knuc1:

Click to download the PDB-style file with coordinates for d3knuc1.
(The format of our PDB-style files is described here.)

Timeline for d3knuc1: