SCOPe 2.07: Domain d1npoc_: 1npo C:

Lineage for d1npoc_ (1npo C:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.9: Neurophysin II [49605] (1 superfamily)
   sandwich; 8 strands in 2 sheets; meander

4. Superfamily b.9.1: Neurophysin II [49606] (1 family)
   duplication: composed of two structural repeats
   automatically mapped to Pfam PF00184

5. Family b.9.1.1: Neurophysin II [49607] (1 protein)

6. Protein Neurophysin II [49608] (1 species)
   can be classified as disulfide-rich

7. Species Cow (Bos taurus) [TaxId:9913] [49609] (11 PDB entries)

8. Domain d1npoc_: 1npo C: [23271]

Details for d1npoc_

PDB Entry: 1npo, 3 Å

PDB Description: bovine neurophysin ii complex with oxytocin

PDB Compounds: (C:) neurophysin II

SCOPe Domain Sequences for d1npoc_:

Sequence; same for both SEQRES and ATOM records:

>d1npoc_ b.9.1.1 (C:) Neurophysin II {Cow (Bos taurus) [TaxId: 9913]}
lrqclpcgpggagrcfgpsiccgdelgcfvgtaealrcqeenylpspcqsgqkpcgsggr
caaagiccndescvtepec

Timeline for d1npoc_:

• d1npoc_ first appeared (with stable ids) in SCOP 1.55
  
• d1npoc_ appears in SCOPe 2.06
  
• d1npoc_ appears in the current release, SCOPe 2.08