Lineage for d1npoa_ (1npo A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2383117Fold b.9: Neurophysin II [49605] (1 superfamily)
    sandwich; 8 strands in 2 sheets; meander
  4. 2383118Superfamily b.9.1: Neurophysin II [49606] (1 family) (S)
    duplication: composed of two structural repeats
    automatically mapped to Pfam PF00184
  5. 2383119Family b.9.1.1: Neurophysin II [49607] (1 protein)
  6. 2383120Protein Neurophysin II [49608] (1 species)
    can be classified as disulfide-rich
  7. 2383121Species Cow (Bos taurus) [TaxId:9913] [49609] (11 PDB entries)
  8. 2383134Domain d1npoa_: 1npo A: [23270]

Details for d1npoa_

PDB Entry: 1npo (more details), 3 Å

PDB Description: bovine neurophysin ii complex with oxytocin
PDB Compounds: (A:) neurophysin II

SCOPe Domain Sequences for d1npoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1npoa_ b.9.1.1 (A:) Neurophysin II {Cow (Bos taurus) [TaxId: 9913]}
lelrqclpcgpggkgrcfgpsiccgdelgcfvgtaealrcqeenylpspcqsgqkpcgsg
grcaaagiccndescvtepec

SCOPe Domain Coordinates for d1npoa_:

Click to download the PDB-style file with coordinates for d1npoa_.
(The format of our PDB-style files is described here.)

Timeline for d1npoa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1npoc_