SCOPe 2.04: Domain d3i2ga2: 3i2g A:352-575

Lineage for d3i2ga2 (3i2g A:352-575)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll

4. Superfamily b.18.1: Galactose-binding domain-like [49785] (33 families)

5. Family b.18.1.0: automated matches [191481] (1 protein)
   not a true family

6. Protein automated matches [190770] (24 species)
   not a true protein

7. Species Rhodococcus sp. [TaxId:104109] [232531] (9 PDB entries)

8. Domain d3i2ga2: 3i2g A:352-575 [232536]
   Other proteins in same PDB: d3i2ga1
   automated match to d1ju3a1
   complexed with cl, dbc, gol, so4; mutant

Details for d3i2ga2

PDB Entry: 3i2g, 2.5 Å

PDB Description: cocaine esterase with mutation g173q, bound to dtt adduct

PDB Compounds: (A:) cocaine esterase

SCOPe Domain Sequences for d3i2ga2:

Sequence; same for both SEQRES and ATOM records:

>d3i2ga2 b.18.1.0 (A:352-575) automated matches {Rhodococcus sp. [TaxId: 104109]}
plpdtaytpfylggsgaantstgggtlstsisgtesadtylydpadpvpslggtllfhng
dngpadqrpihdrddvlcystevltdpvevtgtvsarlfvsssavdtdftaklvdvfpdg
raialcdgivrmryretlvnptlieageiyevaidmlatsnvflpghrimvqvsssnfpk
ydrnsntggviareqleemctavnrihrgpehpshivlpiikrk

Timeline for d3i2ga2:

• d3i2ga2 first appeared in SCOPe 2.03
  
• d3i2ga2 appears in SCOPe 2.05
  
• d3i2ga2 appears in the current release, SCOPe 2.08