Lineage for d3hv1b1 (3hv1 B:28-280)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1624948Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 1624949Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 1626115Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 1626116Protein automated matches [190039] (87 species)
    not a true protein
  7. 1626617Species Streptococcus thermophilus [TaxId:264199] [232515] (1 PDB entry)
  8. 1626619Domain d3hv1b1: 3hv1 B:28-280 [232517]
    automated match to d2pvua_

Details for d3hv1b1

PDB Entry: 3hv1 (more details), 1.9 Å

PDB Description: crystal structure of a polar amino acid abc uptake transporter substrate binding protein from streptococcus thermophilus
PDB Compounds: (B:) Polar amino acid ABC uptake transporter substrate binding protein

SCOPe Domain Sequences for d3hv1b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hv1b1 c.94.1.0 (B:28-280) automated matches {Streptococcus thermophilus [TaxId: 264199]}
shfatqkdqwqtytkekkikigfdatfvpmgyeekdgsyigfdidlanavfklygidvew
qaidwdmketelkngtidliwngysvtderkqsadftepymvneqvlvtkkssgidsvag
magktlgaqagssgydafnaspkilkdvvanqkvvqystftqalidlnsgridgllidrv
yanyyleksgvldqynvmpagyegesfavgarkvdktlikkinqgfetlykngefqkisn
kwfgedvatdqvk

SCOPe Domain Coordinates for d3hv1b1:

Click to download the PDB-style file with coordinates for d3hv1b1.
(The format of our PDB-style files is described here.)

Timeline for d3hv1b1: