Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) Similar in architecture to the superfamily I but partly differs in topology |
Family c.94.1.0: automated matches [191309] (1 protein) not a true family |
Protein automated matches [190039] (87 species) not a true protein |
Species Streptococcus thermophilus [TaxId:264199] [232515] (1 PDB entry) |
Domain d3hv1b1: 3hv1 B:28-280 [232517] automated match to d2pvua_ |
PDB Entry: 3hv1 (more details), 1.9 Å
SCOPe Domain Sequences for d3hv1b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3hv1b1 c.94.1.0 (B:28-280) automated matches {Streptococcus thermophilus [TaxId: 264199]} shfatqkdqwqtytkekkikigfdatfvpmgyeekdgsyigfdidlanavfklygidvew qaidwdmketelkngtidliwngysvtderkqsadftepymvneqvlvtkkssgidsvag magktlgaqagssgydafnaspkilkdvvanqkvvqystftqalidlnsgridgllidrv yanyyleksgvldqynvmpagyegesfavgarkvdktlikkinqgfetlykngefqkisn kwfgedvatdqvk
Timeline for d3hv1b1: