SCOPe 2.08: Domain d3hg3a1: 3hg3 A:32-323

Lineage for d3hg3a1 (3hg3 A:32-323)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins)
   members of the family may contain various insert subdomains
   in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain

6. Protein Melibiase [75064] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [102062] (21 PDB entries)
   alpha-galactosidase A

8. Domain d3hg3a1: 3hg3 A:32-323 [232468]
   Other proteins in same PDB: d3hg3a2, d3hg3b2
   automated match to d1r46a2
   complexed with 2pe, nag
   missing some secondary structures that made up less than one-third of the common domain

Details for d3hg3a1

PDB Entry: 3hg3, 1.9 Å

PDB Description: human alpha-galactosidase catalytic mechanism 2. substrate bound

PDB Compounds: (A:) Alpha-galactosidase A

SCOPe Domain Sequences for d3hg3a1:

Sequence; same for both SEQRES and ATOM records:

>d3hg3a1 c.1.8.1 (A:32-323) Melibiase {Human (Homo sapiens) [TaxId: 9606]}
ldnglartptmgwlhwerfmcnldcqeepdsciseklfmemaelmvsegwkdagyeylci
ddcwmapqrdsegrlqadpqrfphgirqlanyvhskglklgiyadvgnktcagfpgsfgy
ydidaqtfadwgvdllkfagcycdslenladgykhmslalnrtgrsivyscewplymwpf
qkpnyteirqycnhwrnfadiddswksiksildwtsfnqerivdvagpggwndpdmlvig
nfglswnqqvtqmalwaimaaplfmsndlrhispqakallqdkdviainqdp

Timeline for d3hg3a1:

• d3hg3a1 first appeared in SCOPe 2.03
  
• d3hg3a1 appears in SCOPe 2.07