Lineage for d1d00f1 (1d00 F:350-501)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1115788Fold b.8: TRAF domain-like [49598] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 1115789Superfamily b.8.1: TRAF domain-like [49599] (2 families) (S)
    has a circularly permuted immunoglobulin-fold topology with extra strand
  5. 1115790Family b.8.1.1: MATH domain [49600] (4 proteins)
  6. 1115806Protein TNF receptor associated factor 2 (TRAF2) [49601] (1 species)
  7. 1115807Species Human (Homo sapiens) [TaxId:9606] [49602] (10 PDB entries)
  8. 1115822Domain d1d00f1: 1d00 F:350-501 [23234]
    Other proteins in same PDB: d1d00a2, d1d00b2, d1d00c2, d1d00d2, d1d00e2, d1d00f2, d1d00g2, d1d00h2

Details for d1d00f1

PDB Entry: 1d00 (more details), 2 Å

PDB Description: structure of tnf receptor associated factor 2 in complex with a 5- residue cd40 peptide
PDB Compounds: (F:) tumor necrosis factor receptor associated protein 2

SCOPe Domain Sequences for d1d00f1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d00f1 b.8.1.1 (F:350-501) TNF receptor associated factor 2 (TRAF2) {Human (Homo sapiens) [TaxId: 9606]}
ydgvfiwkisdfarkrqeavagripaifspafytsrygykmclriylngdgtgrgthlsl
ffvvmkgpndallrwpfnqkvtlmlldqnnrehvidafrpdvtsssfqrpvndmniasgc
plfcpvskmeaknsyvrddaifikaivdltgl

SCOPe Domain Coordinates for d1d00f1:

Click to download the PDB-style file with coordinates for d1d00f1.
(The format of our PDB-style files is described here.)

Timeline for d1d00f1: