Lineage for d1d00f1 (1d00 F:350-501)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 11382Fold b.8: TRAF domain [49598] (1 superfamily)
  4. 11383Superfamily b.8.1: TRAF domain [49599] (1 family) (S)
  5. 11384Family b.8.1.1: TRAF domain [49600] (2 proteins)
  6. 11385Protein TNF receptor associated factor 2 (TRAF2) [49601] (1 species)
  7. 11386Species Human (Homo sapiens) [TaxId:9606] [49602] (9 PDB entries)
  8. 11395Domain d1d00f1: 1d00 F:350-501 [23234]
    Other proteins in same PDB: d1d00a2, d1d00b2, d1d00c2, d1d00d2, d1d00e2, d1d00f2, d1d00g2, d1d00h2

Details for d1d00f1

PDB Entry: 1d00 (more details), 2 Å

PDB Description: structure of tnf receptor associated factor 2 in complex with a 5- residue cd40 peptide

SCOP Domain Sequences for d1d00f1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d00f1 b.8.1.1 (F:350-501) TNF receptor associated factor 2 (TRAF2) {Human (Homo sapiens)}
ydgvfiwkisdfarkrqeavagripaifspafytsrygykmclriylngdgtgrgthlsl
ffvvmkgpndallrwpfnqkvtlmlldqnnrehvidafrpdvtsssfqrpvndmniasgc
plfcpvskmeaknsyvrddaifikaivdltgl

SCOP Domain Coordinates for d1d00f1:

Click to download the PDB-style file with coordinates for d1d00f1.
(The format of our PDB-style files is described here.)

Timeline for d1d00f1: