SCOPe 2.06: Domain d3gvka1: 3gvk A:267-760

Lineage for d3gvka1 (3gvk A:267-760)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
   consists of six 4-stranded beta-sheet motifs; meander

4. Superfamily b.68.1: Sialidases [50939] (3 families)

5. Family b.68.1.2: Endo-alpha-sialidase [117276] (2 proteins)
   possibly related by the other family by circular permutation; includes extra N-terminal domain [dN: alpha/beta ] and insert domain [dI: beta-barrel, similar to the Reductase/isomerase/elongation factor common domain (50412)]

6. Protein automated matches [232323] (1 species)
   not a true protein

7. Species Enterobacteria phage [TaxId:344021] [232324] (4 PDB entries)

8. Domain d3gvka1: 3gvk A:267-760 [232329]
   Other proteins in same PDB: d3gvka2, d3gvkb2, d3gvkb3, d3gvkc2, d3gvkc3
   automated match to d1v0ea1
   complexed with na; mutant

Details for d3gvka1

PDB Entry: 3gvk, 1.84 Å

PDB Description: crystal structure of endo-neuraminidase nf mutant

PDB Compounds: (A:) Endo-N-acetylneuraminidase

SCOPe Domain Sequences for d3gvka1:

Sequence; same for both SEQRES and ATOM records:

>d3gvka1 b.68.1.2 (A:267-760) automated matches {Enterobacteria phage [TaxId: 344021]}
vgqkingngktykvtslpdisrfintrfvyeripgqplyyaseefvqgelfkitdtpyyn
awpqdkafvyenviyapymgsdragvsrlhvswvksgddgqtwstpewltdlhpdyptvn
yhcmsmgvcrnrlfamietrtlaknaltncalwdrpmsrslhltggitkaanqryatihv
pdhglfvgdfvnfsnsavtgvsgdmtvatvidkdnftvltpnqqtsdlnnagknwhmgts
fhkspwrktdlglipsvtevhsfatidnngfamgyhqgdvaprevglfyfpdafnspsny
vrrqipseyepdasepcikyydgvlylitrgtrgdrlgsslhrsrdigqtweslrfphnv
hhttlpfakvgddlimfgseraeneweagapddrykasyprtfyarlnvnnwnaddiewv
nitdqiyqggivnsgvgvgsvvvkdnyiyymfggedhfnpwtygdnsakdpfksdghpsd
lycykmkigpdnrv

Timeline for d3gvka1:

• d3gvka1 first appeared in SCOPe 2.03
  
• d3gvka1 appears in SCOPe 2.05
  
• d3gvka1 appears in SCOPe 2.07
  
• d3gvka1 appears in the current release, SCOPe 2.08