| Class b: All beta proteins [48724] (176 folds) |
| Fold b.33: ISP domain [50021] (1 superfamily) consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8) |
Superfamily b.33.1: ISP domain [50022] (4 families) ![]() |
| Family b.33.1.0: automated matches [191455] (1 protein) not a true family |
| Protein automated matches [190701] (10 species) not a true protein |
| Species Nocardioides aromaticivorans [TaxId:200618] [196555] (2 PDB entries) |
| Domain d3gcfb1: 3gcf B:16-148 [232275] Other proteins in same PDB: d3gcfa2, d3gcfb2, d3gcfc2, d3gcfd2, d3gcfe2, d3gcff2, d3gcfg2, d3gcfh2, d3gcfi2, d3gcfj2, d3gcfk2, d3gcfl2, d3gcfm2, d3gcfn2, d3gcfo2 automated match to d2de6a1 complexed with cl, fe2, fes |
PDB Entry: 3gcf (more details), 2.3 Å
SCOPe Domain Sequences for d3gcfb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3gcfb1 b.33.1.0 (B:16-148) automated matches {Nocardioides aromaticivorans [TaxId: 200618]}
saqvkwpryleatlgfdnhwhpaafdhelaegefvavtmlgekvlltrakgevkaiadgc
ahrgvpfskeplcfkagtvscwyhgwtydlddgrlvdvltspgspvigkigikvypvqva
qgvvfvfigdeep
Timeline for d3gcfb1:
View in 3DDomains from other chains: (mouse over for more information) d3gcfa1, d3gcfa2, d3gcfc1, d3gcfc2, d3gcfd1, d3gcfd2, d3gcfe1, d3gcfe2, d3gcff1, d3gcff2, d3gcfg1, d3gcfg2, d3gcfh1, d3gcfh2, d3gcfi1, d3gcfi2, d3gcfj1, d3gcfj2, d3gcfk1, d3gcfk2, d3gcfl1, d3gcfl2, d3gcfm1, d3gcfm2, d3gcfn1, d3gcfn2, d3gcfo1, d3gcfo2 |