Lineage for d3gcfj1 (3gcf J:16-148)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1782956Fold b.33: ISP domain [50021] (1 superfamily)
    consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8)
  4. 1782957Superfamily b.33.1: ISP domain [50022] (4 families) (S)
  5. 1783175Family b.33.1.0: automated matches [191455] (1 protein)
    not a true family
  6. 1783176Protein automated matches [190701] (10 species)
    not a true protein
  7. 1783248Species Nocardioides aromaticivorans [TaxId:200618] [196555] (2 PDB entries)
  8. 1783259Domain d3gcfj1: 3gcf J:16-148 [239308]
    Other proteins in same PDB: d3gcfa2, d3gcfb2, d3gcfc2, d3gcfd2, d3gcfe2, d3gcff2, d3gcfg2, d3gcfh2, d3gcfi2, d3gcfj2, d3gcfk2, d3gcfl2, d3gcfm2, d3gcfn2, d3gcfo2
    automated match to d3gcfa1
    complexed with cl, fe2, fes

Details for d3gcfj1

PDB Entry: 3gcf (more details), 2.3 Å

PDB Description: Terminal oxygenase of carbazole 1,9a-dioxygenase from Nocardioides aromaticivorans IC177
PDB Compounds: (J:) Terminal oxygenase component of carbazole 1,9a-dioxygenase

SCOPe Domain Sequences for d3gcfj1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gcfj1 b.33.1.0 (J:16-148) automated matches {Nocardioides aromaticivorans [TaxId: 200618]}
saqvkwpryleatlgfdnhwhpaafdhelaegefvavtmlgekvlltrakgevkaiadgc
ahrgvpfskeplcfkagtvscwyhgwtydlddgrlvdvltspgspvigkigikvypvqva
qgvvfvfigdeep

SCOPe Domain Coordinates for d3gcfj1:

Click to download the PDB-style file with coordinates for d3gcfj1.
(The format of our PDB-style files is described here.)

Timeline for d3gcfj1: