SCOPe 2.08: Domain d3gcfb1: 3gcf B:16-148

Lineage for d3gcfb1 (3gcf B:16-148)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.33: ISP domain [50021] (1 superfamily)
   consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8)

4. Superfamily b.33.1: ISP domain [50022] (4 families)

5. Family b.33.1.0: automated matches [191455] (1 protein)
   not a true family

6. Protein automated matches [190701] (13 species)
   not a true protein

7. Species Nocardioides aromaticivorans [TaxId:200618] [196555] (2 PDB entries)

8. Domain d3gcfb1: 3gcf B:16-148 [232275]
   Other proteins in same PDB: d3gcfa2, d3gcfb2, d3gcfc2, d3gcfd2, d3gcfe2, d3gcff2, d3gcfg2, d3gcfh2, d3gcfi2, d3gcfj2, d3gcfk2, d3gcfl2, d3gcfm2, d3gcfn2, d3gcfo2
   automated match to d2de6a1
   complexed with cl, fe2, fes

Details for d3gcfb1

PDB Entry: 3gcf, 2.3 Å

PDB Description: Terminal oxygenase of carbazole 1,9a-dioxygenase from Nocardioides aromaticivorans IC177

PDB Compounds: (B:) Terminal oxygenase component of carbazole 1,9a-dioxygenase

SCOPe Domain Sequences for d3gcfb1:

Sequence; same for both SEQRES and ATOM records:

>d3gcfb1 b.33.1.0 (B:16-148) automated matches {Nocardioides aromaticivorans [TaxId: 200618]}
saqvkwpryleatlgfdnhwhpaafdhelaegefvavtmlgekvlltrakgevkaiadgc
ahrgvpfskeplcfkagtvscwyhgwtydlddgrlvdvltspgspvigkigikvypvqva
qgvvfvfigdeep

Timeline for d3gcfb1:

• d3gcfb1 first appeared in SCOPe 2.03
  
• d3gcfb1 appears in SCOPe 2.07