SCOPe 2.08: Domain d3fk4b1: 3fk4 B:3-121

Lineage for d3fk4b1 (3fk4 B:3-121)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families)
   C-terminal domain is beta/alpha barrel

5. Family d.58.9.0: automated matches [227234] (1 protein)
   not a true family

6. Protein automated matches [226983] (27 species)
   not a true protein

7. Species Bacillus cereus [TaxId:226900] [232167] (1 PDB entry)

8. Domain d3fk4b1: 3fk4 B:3-121 [232169]
   Other proteins in same PDB: d3fk4a2, d3fk4b2
   automated match to d4nasa1

Details for d3fk4b1

PDB Entry: 3fk4, 2 Å

PDB Description: crystal structure of rubisco-like protein from bacillus cereus atcc 14579

PDB Compounds: (B:) RuBisCO-like protein

SCOPe Domain Sequences for d3fk4b1:

Sequence, based on SEQRES records:

>d3fk4b1 d.58.9.0 (B:3-121) automated matches {Bacillus cereus [TaxId: 226900]}
giiatylihddshnlekkaeqialgltigswthlphllqeqlkqhkgnvihveelaeheh
tnsylrkkvkrgiikieypllnfspdlpailtttfgklsldgevklidltfsdelkkhf

Sequence, based on observed residues (ATOM records):

>d3fk4b1 d.58.9.0 (B:3-121) automated matches {Bacillus cereus [TaxId: 226900]}
giiatylihddshnlekkaeqialgltiglphllqeqlkqhkgnvihveelaehehtnsy
lrkkvkrgiikieypllnfspdlpailtttfgklsldgevklidltfsdelkkhf

Timeline for d3fk4b1:

• d3fk4b1 first appeared in SCOPe 2.03
  
• d3fk4b1 appears in SCOPe 2.07