Lineage for d3fk4a1 (3fk4 A:3-121)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2952777Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families) (S)
    C-terminal domain is beta/alpha barrel
  5. 2952998Family d.58.9.0: automated matches [227234] (1 protein)
    not a true family
  6. 2952999Protein automated matches [226983] (27 species)
    not a true protein
  7. 2953005Species Bacillus cereus [TaxId:226900] [232167] (1 PDB entry)
  8. 2953006Domain d3fk4a1: 3fk4 A:3-121 [232168]
    Other proteins in same PDB: d3fk4a2, d3fk4b2
    automated match to d4nasa1

Details for d3fk4a1

PDB Entry: 3fk4 (more details), 2 Å

PDB Description: crystal structure of rubisco-like protein from bacillus cereus atcc 14579
PDB Compounds: (A:) RuBisCO-like protein

SCOPe Domain Sequences for d3fk4a1:

Sequence, based on SEQRES records: (download)

>d3fk4a1 d.58.9.0 (A:3-121) automated matches {Bacillus cereus [TaxId: 226900]}
giiatylihddshnlekkaeqialgltigswthlphllqeqlkqhkgnvihveelaeheh
tnsylrkkvkrgiikieypllnfspdlpailtttfgklsldgevklidltfsdelkkhf

Sequence, based on observed residues (ATOM records): (download)

>d3fk4a1 d.58.9.0 (A:3-121) automated matches {Bacillus cereus [TaxId: 226900]}
giiatylihddshnlekkaeqialgltigeqlkqhkgnvihveelaehehtnsylrkkvk
rgiikieypllnfspdlpailtttfgklsldgevklidltfsdelkkhf

SCOPe Domain Coordinates for d3fk4a1:

Click to download the PDB-style file with coordinates for d3fk4a1.
(The format of our PDB-style files is described here.)

Timeline for d3fk4a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3fk4a2