Lineage for d3fk4b2 (3fk4 B:122-406)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2088460Superfamily c.1.14: RuBisCo, C-terminal domain [51649] (2 families) (S)
    automatically mapped to Pfam PF00016
  5. 2088773Family c.1.14.0: automated matches [227297] (1 protein)
    not a true family
  6. 2088774Protein automated matches [227123] (7 species)
    not a true protein
  7. 2088780Species Bacillus cereus [TaxId:226900] [232179] (1 PDB entry)
  8. 2088782Domain d3fk4b2: 3fk4 B:122-406 [232180]
    Other proteins in same PDB: d3fk4a1, d3fk4b1
    automated match to d4nasa2

Details for d3fk4b2

PDB Entry: 3fk4 (more details), 2 Å

PDB Description: Crystal structure of RuBisCO-like protein from Bacillus Cereus ATCC 14579
PDB Compounds: (B:) RuBisCO-like protein

SCOPe Domain Sequences for d3fk4b2:

Sequence, based on SEQRES records: (download)

>d3fk4b2 c.1.14.0 (B:122-406) automated matches {Bacillus cereus [TaxId: 226900]}
pgpkfgidgirnllqvhdrpllmsifkgmigrnigylktqlrdqaiggvdivkddeilfe
naltpltkrivsgkevlqsvyetyghktlyavnltgrtfdlkenakravqagadillfnv
faygldvlqslaeddeipvpimahpavsgaysasklygvssplllgkllryagadfslfp
spygsvalekeealaiskylteddasfkksfsvpsagihpgfvpfivrdfgkdvvinagg
gihghpngaqgggkafrtaidatlqnkplhevddinlhsalqiwg

Sequence, based on observed residues (ATOM records): (download)

>d3fk4b2 c.1.14.0 (B:122-406) automated matches {Bacillus cereus [TaxId: 226900]}
pgpkfgidgirnllqvhdrpllmsifkgmigrnigylktqlrdqaiggvdivkddeilfl
tpltkrivsgkevlqsvyetyghktlyavnltgrtfdlkenakravqagadillfnvfay
gldvlqslaeddeipvpimahpavsgaysasklygvssplllgkllryagadfslfpspy
keealaiskylteddasfkksfsvpsagihpgfvpfivrdfgkdvvinagggihghpnga
qgggkafrtaidatlqnkplhevddinlhsalqiwg

SCOPe Domain Coordinates for d3fk4b2:

Click to download the PDB-style file with coordinates for d3fk4b2.
(The format of our PDB-style files is described here.)

Timeline for d3fk4b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3fk4b1