SCOPe 2.05: Domain d3f2hb2: 3f2h B:81-208

Lineage for d3f2hb2 (3f2h B:81-208)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.357: NosL/MerB-like [160386] (1 superfamily)
   unusual fold; comprises two structural repeats of beta(2)-alpha-beta motifs, forming separate beta-sheets; probable duplication

4. Superfamily d.357.1: NosL/MerB-like [160387] (2 families)

5. Family d.357.1.2: MerB-like [160391] (1 protein)
   Pfam PF03243

6. Protein Alkylmercury lyase MerB [160392] (1 species)

7. Species Escherichia coli [TaxId:562] [160393] (7 PDB entries)
   Uniprot P77072 81-212

8. Domain d3f2hb2: 3f2h B:81-208 [232143]
   Other proteins in same PDB: d3f2ha1, d3f2hb1
   automated match to d3f0oa2
   complexed with hg; mutant

Details for d3f2hb2

PDB Entry: 3f2h, 2 Å

PDB Description: crystal structure of the mercury-bound form of merb mutant c160s, the organomercurial lyase involved in a bacterial mercury resistance system

PDB Compounds: (B:) Alkylmercury lyase

SCOPe Domain Sequences for d3f2hb2:

Sequence, based on SEQRES records:

>d3f2hb2 d.357.1.2 (B:81-208) Alkylmercury lyase MerB {Escherichia coli [TaxId: 562]}
tsyvfeiddrrlyawcaldtlifpaligrtarvsshcaatgapvsltvspseiqavepag
mavslvlpqeaadvrqsfcshvhffasvptaedwaskhqgleglaivsvheafglgqefn
rhllqtms

Sequence, based on observed residues (ATOM records):

>d3f2hb2 d.357.1.2 (B:81-208) Alkylmercury lyase MerB {Escherichia coli [TaxId: 562]}
tsyvfeirrlyawcaldtlifpaligrtarvsshcaatgapvsltvspseiqavepagma
vslvlpqeaadvrqsfcshvhffasvptaedwaskhqgleglaivsvheafglgqefnrh
llqtms

Timeline for d3f2hb2:

• d3f2hb2 first appeared in SCOPe 2.03
  
• d3f2hb2 appears in SCOPe 2.04
  
• d3f2hb2 appears in SCOPe 2.06
  
• d3f2hb2 appears in the current release, SCOPe 2.08