Class a: All alpha proteins [46456] (286 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) contains a small beta-sheet (wing) |
Family a.4.5.79: MerB N-terminal domain-like [158323] (1 protein) |
Protein Alkylmercury lyase MerB [158324] (1 species) |
Species Escherichia coli [TaxId:562] [158325] (7 PDB entries) Uniprot P77072 21-80 |
Domain d3f2hb1: 3f2h B:1-80 [232142] Other proteins in same PDB: d3f2ha2, d3f2hb2 automated match to d3f0oa1 complexed with hg; mutant |
PDB Entry: 3f2h (more details), 2 Å
SCOPe Domain Sequences for d3f2hb1:
Sequence, based on SEQRES records: (download)
>d3f2hb1 a.4.5.79 (B:1-80) Alkylmercury lyase MerB {Escherichia coli [TaxId: 562]} mklapyilelltsvnrtngtadllvpllrelakgrpvsrttlagildwpaervaavleqa tsteydkdgniigygltlre
>d3f2hb1 a.4.5.79 (B:1-80) Alkylmercury lyase MerB {Escherichia coli [TaxId: 562]} mklapyilelltsvntadllvpllrelakgrpvsrttlagildwpaervaavleqatste ydkdgniigygltlre
Timeline for d3f2hb1: