Lineage for d3f2hb2 (3f2h B:81-208)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1449522Fold d.357: NosL/MerB-like [160386] (1 superfamily)
    unusual fold; comprises two structural repeats of beta(2)-alpha-beta motifs, forming separate beta-sheets; probable duplication
  4. 1449523Superfamily d.357.1: NosL/MerB-like [160387] (2 families) (S)
  5. 1449529Family d.357.1.2: MerB-like [160391] (1 protein)
    Pfam PF03243
  6. 1449530Protein Alkylmercury lyase MerB [160392] (1 species)
  7. 1449531Species Escherichia coli [TaxId:562] [160393] (7 PDB entries)
    Uniprot P77072 81-212
  8. 1449543Domain d3f2hb2: 3f2h B:81-208 [232143]
    Other proteins in same PDB: d3f2ha1, d3f2hb1
    automated match to d3f0oa2
    complexed with hg; mutant

Details for d3f2hb2

PDB Entry: 3f2h (more details), 2 Å

PDB Description: crystal structure of the mercury-bound form of merb mutant c160s, the organomercurial lyase involved in a bacterial mercury resistance system
PDB Compounds: (B:) Alkylmercury lyase

SCOPe Domain Sequences for d3f2hb2:

Sequence, based on SEQRES records: (download)

>d3f2hb2 d.357.1.2 (B:81-208) Alkylmercury lyase MerB {Escherichia coli [TaxId: 562]}
tsyvfeiddrrlyawcaldtlifpaligrtarvsshcaatgapvsltvspseiqavepag
mavslvlpqeaadvrqsfcshvhffasvptaedwaskhqgleglaivsvheafglgqefn
rhllqtms

Sequence, based on observed residues (ATOM records): (download)

>d3f2hb2 d.357.1.2 (B:81-208) Alkylmercury lyase MerB {Escherichia coli [TaxId: 562]}
tsyvfeirrlyawcaldtlifpaligrtarvsshcaatgapvsltvspseiqavepagma
vslvlpqeaadvrqsfcshvhffasvptaedwaskhqgleglaivsvheafglgqefnrh
llqtms

SCOPe Domain Coordinates for d3f2hb2:

Click to download the PDB-style file with coordinates for d3f2hb2.
(The format of our PDB-style files is described here.)

Timeline for d3f2hb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3f2hb1