SCOPe 2.07: Domain d3f2ha1: 3f2h A:1-80

Lineage for d3f2ha1 (3f2h A:1-80)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.79: MerB N-terminal domain-like [158323] (1 protein)

6. Protein Alkylmercury lyase MerB [158324] (1 species)

7. Species Escherichia coli [TaxId:562] [158325] (17 PDB entries)
   Uniprot P77072 21-80

8. Domain d3f2ha1: 3f2h A:1-80 [232140]
   Other proteins in same PDB: d3f2ha2, d3f2hb2
   automated match to d3f0oa1
   complexed with hg; mutant

Details for d3f2ha1

PDB Entry: 3f2h, 2 Å

PDB Description: crystal structure of the mercury-bound form of merb mutant c160s, the organomercurial lyase involved in a bacterial mercury resistance system

PDB Compounds: (A:) Alkylmercury lyase

SCOPe Domain Sequences for d3f2ha1:

Sequence, based on SEQRES records:

>d3f2ha1 a.4.5.79 (A:1-80) Alkylmercury lyase MerB {Escherichia coli [TaxId: 562]}
mklapyilelltsvnrtngtadllvpllrelakgrpvsrttlagildwpaervaavleqa
tsteydkdgniigygltlre

Sequence, based on observed residues (ATOM records):

>d3f2ha1 a.4.5.79 (A:1-80) Alkylmercury lyase MerB {Escherichia coli [TaxId: 562]}
mklapyilelltsvngtadllvpllrelakgrpvsrttlagildwpaervaavleqatst
eydkdgniigygltlre

Timeline for d3f2ha1:

• d3f2ha1 first appeared in SCOPe 2.03
  
• d3f2ha1 appears in SCOPe 2.06
  
• d3f2ha1 appears in the current release, SCOPe 2.08