Class a: All alpha proteins [46456] (289 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families) contains a small beta-sheet (wing) |
Family a.4.5.79: MerB N-terminal domain-like [158323] (1 protein) |
Protein Alkylmercury lyase MerB [158324] (1 species) |
Species Escherichia coli [TaxId:562] [158325] (17 PDB entries) Uniprot P77072 21-80 |
Domain d3f0oa1: 3f0o A:1-80 [209759] Other proteins in same PDB: d3f0oa2, d3f0ob2 automated match to d1s6la1 complexed with br |
PDB Entry: 3f0o (more details), 1.76 Å
SCOPe Domain Sequences for d3f0oa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3f0oa1 a.4.5.79 (A:1-80) Alkylmercury lyase MerB {Escherichia coli [TaxId: 562]} mklapyilelltsvnrtngtadllvpllrelakgrpvsrttlagildwpaervaavleqa tsteydkdgniigygltlre
Timeline for d3f0oa1: