SCOPe 2.07: Domain d3f0oa2: 3f0o A:81-208

Lineage for d3f0oa2 (3f0o A:81-208)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.357: NosL/MerB-like [160386] (1 superfamily)
   unusual fold; comprises two structural repeats of beta(2)-alpha-beta motifs, forming separate beta-sheets; probable duplication

4. Superfamily d.357.1: NosL/MerB-like [160387] (2 families)

5. Family d.357.1.2: MerB-like [160391] (1 protein)
   Pfam PF03243

6. Protein Alkylmercury lyase MerB [160392] (1 species)

7. Species Escherichia coli [TaxId:562] [160393] (17 PDB entries)
   Uniprot P77072 81-212

8. Domain d3f0oa2: 3f0o A:81-208 [209760]
   Other proteins in same PDB: d3f0oa1, d3f0ob1
   automated match to d1s6la2
   complexed with br

Details for d3f0oa2

PDB Entry: 3f0o, 1.76 Å

PDB Description: Crystal structure of MerB, the Organomercurial Lyase involved in a bacterial mercury resistance system

PDB Compounds: (A:) Alkylmercury lyase

SCOPe Domain Sequences for d3f0oa2:

Sequence; same for both SEQRES and ATOM records:

>d3f0oa2 d.357.1.2 (A:81-208) Alkylmercury lyase MerB {Escherichia coli [TaxId: 562]}
tsyvfeiddrrlyawcaldtlifpaligrtarvsshcaatgapvsltvspseiqavepag
mavslvlpqeaadvrqsfcchvhffasvptaedwaskhqgleglaivsvheafglgqefn
rhllqtms

Timeline for d3f0oa2:

• d3f0oa2 first appeared in SCOPe 2.03
  
• d3f0oa2 appears in SCOPe 2.06
  
• d3f0oa2 appears in the current release, SCOPe 2.08