| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.357: NosL/MerB-like [160386] (1 superfamily) unusual fold; comprises two structural repeats of beta(2)-alpha-beta motifs, forming separate beta-sheets; probable duplication |
Superfamily d.357.1: NosL/MerB-like [160387] (2 families) ![]() |
| Family d.357.1.2: MerB-like [160391] (1 protein) Pfam PF03243 |
| Protein Alkylmercury lyase MerB [160392] (1 species) |
| Species Escherichia coli [TaxId:562] [160393] (7 PDB entries) Uniprot P77072 81-212 |
| Domain d3f0oa2: 3f0o A:81-208 [209760] Other proteins in same PDB: d3f0oa1, d3f0ob1 automated match to d1s6la2 complexed with br |
PDB Entry: 3f0o (more details), 1.76 Å
SCOPe Domain Sequences for d3f0oa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3f0oa2 d.357.1.2 (A:81-208) Alkylmercury lyase MerB {Escherichia coli [TaxId: 562]}
tsyvfeiddrrlyawcaldtlifpaligrtarvsshcaatgapvsltvspseiqavepag
mavslvlpqeaadvrqsfcchvhffasvptaedwaskhqgleglaivsvheafglgqefn
rhllqtms
Timeline for d3f0oa2: