Lineage for d3eubb2 (3eub B:415-527)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1660045Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies)
    core: beta(3,4)-alpha(3); alpha+beta sandwich
  4. 1660205Superfamily d.87.2: CO dehydrogenase flavoprotein C-terminal domain-like [55447] (2 families) (S)
    automatically mapped to Pfam PF03450
  5. 1660267Family d.87.2.0: automated matches [232089] (1 protein)
    not a true family
  6. 1660268Protein automated matches [232090] (2 species)
    not a true protein
  7. 1660269Species Cow (Bos taurus) [TaxId:9913] [232091] (10 PDB entries)
  8. 1660287Domain d3eubb2: 3eub B:415-527 [232095]
    Other proteins in same PDB: d3eub21, d3eub22, d3eub31, d3eub41, d3eub42, d3euba1, d3euba2, d3eubb1, d3eubc1, d3eubc2, d3eubj1, d3eubj2, d3eubk1, d3eubl1, d3eubl2, d3eubs1, d3eubs2, d3eubt1, d3eubu1, d3eubu2
    automated match to d1v97a4
    complexed with fad, fes, mom, mte, xan

Details for d3eubb2

PDB Entry: 3eub (more details), 2.6 Å

PDB Description: Crystal Structure of Desulfo-Xanthine Oxidase with Xanthine
PDB Compounds: (B:) Xanthine dehydrogenase/oxidase

SCOPe Domain Sequences for d3eubb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3eubb2 d.87.2.0 (B:415-527) automated matches {Cow (Bos taurus) [TaxId: 9913]}
deffsafkqasrreddiakvtcgmrvlfqpgsmqvkelalcyggmadrtisalkttqkql
skfwnekllqdvcaglaeelslspdapggmiefrrtltlsfffkfyltvlkkl

SCOPe Domain Coordinates for d3eubb2:

Click to download the PDB-style file with coordinates for d3eubb2.
(The format of our PDB-style files is described here.)

Timeline for d3eubb2: