Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) |
Family d.15.4.2: 2Fe-2S ferredoxin domains from multidomain proteins [54312] (14 proteins) |
Protein automated matches [231466] (4 species) not a true protein |
Species Cow (Bos taurus) [TaxId:9913] [232069] (9 PDB entries) |
Domain d3euba1: 3eub A:4-92 [232081] Other proteins in same PDB: d3eub22, d3eub31, d3eub32, d3eub41, d3eub42, d3euba2, d3eubb1, d3eubb2, d3eubc1, d3eubc2, d3eubj2, d3eubk1, d3eubk2, d3eubl1, d3eubl2, d3eubs2, d3eubt1, d3eubt2, d3eubu1, d3eubu2 automated match to d1fiqa2 complexed with fad, fes, mom, mte, xan |
PDB Entry: 3eub (more details), 2.6 Å
SCOPe Domain Sequences for d3euba1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3euba1 d.15.4.2 (A:4-92) automated matches {Cow (Bos taurus) [TaxId: 9913]} delvffvngkkvveknadpettllaylrrklglrgtklgcgeggcgactvmlskydrlqd kiihfsanaclapictlhhvavttvegig
Timeline for d3euba1: