SCOP 1.75: Domain d1qune2: 1qun E:122-205

Lineage for d1qune2 (1qun E:122-205)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.7: C2 domain-like [49561] (5 superfamilies)
   sandwich; 8 strands in 2 sheets; greek-key

4. Superfamily b.7.2: Periplasmic chaperone C-domain [49584] (1 family)

5. Family b.7.2.1: Periplasmic chaperone C-domain [49585] (5 proteins)

6. Protein FimC [49588] (1 species)

7. Species Escherichia coli [TaxId:562] [49589] (6 PDB entries)

8. Domain d1qune2: 1qun E:122-205 [23208]
   Other proteins in same PDB: d1quna1, d1qunb1, d1qunb2, d1qunc1, d1qund1, d1qund2, d1qune1, d1qunf1, d1qunf2, d1qung1, d1qunh1, d1qunh2, d1quni1, d1qunj1, d1qunj2, d1qunk1, d1qunl1, d1qunl2, d1qunm1, d1qunn1, d1qunn2, d1quno1, d1qunp1, d1qunp2

Details for d1qune2

PDB Entry: 1qun, 2.8 Å

PDB Description: x-ray structure of the fimc-fimh chaperone adhesin complex from uropathogenic e.coli

PDB Compounds: (E:) papd-like chaperone fimc

SCOP Domain Sequences for d1qune2:

Sequence, based on SEQRES records:

>d1qune2 b.7.2.1 (E:122-205) FimC {Escherichia coli [TaxId: 562]}
lppdqaaeklrfrrsansltlinptpyyltvtelnagtrvlenalvppmgesavklpsda
gsnityrtindygaltpkmtgvme

Sequence, based on observed residues (ATOM records):

>d1qune2 b.7.2.1 (E:122-205) FimC {Escherichia coli [TaxId: 562]}
lppdqaaeklrfrrsansltlinptpyyltvtelnagtrvlenalvppmgesavklsnit
yrtindygaltpkmtgvme

Timeline for d1qune2:

• d1qune2 first appeared (with stable ids) in SCOP 1.55
  
• d1qune2 appears in SCOP 1.73
  
• d1qune2 appears in SCOPe 2.01
  
• d1qune2 appears in the current release, SCOPe 2.08