Lineage for d1qunc1 (1qun C:1-121)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 788734Superfamily b.1.11: PapD-like [49354] (2 families) (S)
    contains PP switch between strands D and C'
  5. 788735Family b.1.11.1: Pilus chaperone [49355] (5 proteins)
  6. 788747Protein Periplasmic chaperone FimC [49358] (1 species)
  7. 788748Species Escherichia coli [TaxId:562] [49359] (6 PDB entries)
  8. 788768Domain d1qunc1: 1qun C:1-121 [22325]
    Other proteins in same PDB: d1quna2, d1qunb1, d1qunb2, d1qunc2, d1qund1, d1qund2, d1qune2, d1qunf1, d1qunf2, d1qung2, d1qunh1, d1qunh2, d1quni2, d1qunj1, d1qunj2, d1qunk2, d1qunl1, d1qunl2, d1qunm2, d1qunn1, d1qunn2, d1quno2, d1qunp1, d1qunp2

Details for d1qunc1

PDB Entry: 1qun (more details), 2.8 Å

PDB Description: x-ray structure of the fimc-fimh chaperone adhesin complex from uropathogenic e.coli
PDB Compounds: (C:) papd-like chaperone fimc

SCOP Domain Sequences for d1qunc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qunc1 b.1.11.1 (C:1-121) Periplasmic chaperone FimC {Escherichia coli [TaxId: 562]}
gvalgatrviypagqkqvqlavtnndenstyliqswvenadgvkdgrfivtpplfamkgk
kentlrildatnnqlpqdreslfwmnvkaipsmdkskltentlqlaiisriklyyrpakl
a

SCOP Domain Coordinates for d1qunc1:

Click to download the PDB-style file with coordinates for d1qunc1.
(The format of our PDB-style files is described here.)

Timeline for d1qunc1: