SCOP 1.75: Domain d1qune1: 1qun E:1-121

Lineage for d1qune1 (1qun E:1-121)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.11: PapD-like [49354] (2 families)
   contains PP switch between strands D and C'

5. Family b.1.11.1: Pilus chaperone [49355] (5 proteins)

6. Protein Periplasmic chaperone FimC [49358] (1 species)

7. Species Escherichia coli [TaxId:562] [49359] (6 PDB entries)

8. Domain d1qune1: 1qun E:1-121 [22326]
   Other proteins in same PDB: d1quna2, d1qunb1, d1qunb2, d1qunc2, d1qund1, d1qund2, d1qune2, d1qunf1, d1qunf2, d1qung2, d1qunh1, d1qunh2, d1quni2, d1qunj1, d1qunj2, d1qunk2, d1qunl1, d1qunl2, d1qunm2, d1qunn1, d1qunn2, d1quno2, d1qunp1, d1qunp2

Details for d1qune1

PDB Entry: 1qun, 2.8 Å

PDB Description: x-ray structure of the fimc-fimh chaperone adhesin complex from uropathogenic e.coli

PDB Compounds: (E:) papd-like chaperone fimc

SCOP Domain Sequences for d1qune1:

Sequence; same for both SEQRES and ATOM records:

>d1qune1 b.1.11.1 (E:1-121) Periplasmic chaperone FimC {Escherichia coli [TaxId: 562]}
gvalgatrviypagqkqvqlavtnndenstyliqswvenadgvkdgrfivtpplfamkgk
kentlrildatnnqlpqdreslfwmnvkaipsmdkskltentlqlaiisriklyyrpakl
a

Timeline for d1qune1:

• d1qune1 first appeared (with stable ids) in SCOP 1.55
  
• d1qune1 appears in SCOP 1.73
  
• d1qune1 appears in SCOPe 2.01
  
• d1qune1 appears in the current release, SCOPe 2.08