Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily) contains large mixed beta-sheet |
Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families) automatically mapped to Pfam PF00303 |
Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins) |
Protein automated matches [190469] (12 species) not a true protein |
Species Cryptosporidium hominis [TaxId:237895] [232024] (3 PDB entries) |
Domain d3dl5d2: 3dl5 D:193-521 [232026] Other proteins in same PDB: d3dl5a1, d3dl5b1, d3dl5c1, d3dl5d1, d3dl5e1 automated match to d1qzfa2 complexed with cb3, dhf, ndp, ump; mutant |
PDB Entry: 3dl5 (more details), 2.74 Å
SCOPe Domain Sequences for d3dl5d2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3dl5d2 d.117.1.1 (D:193-521) automated matches {Cryptosporidium hominis [TaxId: 237895]} lksiddtvdllgeifgirkmgnrhkfpkeeiyntpsirfgrehyefqyldllsrvlenga yrenrtgistysifgqmmrfdmresfpllttkkvfirsifeeliwfikgdtngnhliekk vyiwsgngskeyleriglghreendlgpiygfqwrhyngeyktmhddytgvgvdqlakli etlknnpkdrrhiltawnpsalsqmalppchvlsqyyvtndnclscnlyqrscdlglgsp fniasyailtmmlaqvcgyepgelaifigdahiyenhltqlkeqlsrtprpfpqlkfkrk veniedfkwedieligyypyptikmdmav
Timeline for d3dl5d2: