Lineage for d3dl5b1 (3dl5 B:3-180)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1871769Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest
  4. 1871770Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) (S)
  5. 1872191Family c.71.1.0: automated matches [191485] (1 protein)
    not a true family
  6. 1872192Protein automated matches [190777] (19 species)
    not a true protein
  7. 1872314Species Cryptosporidium hominis [TaxId:237895] [231999] (4 PDB entries)
  8. 1872316Domain d3dl5b1: 3dl5 B:3-180 [232002]
    Other proteins in same PDB: d3dl5b2, d3dl5c2, d3dl5d2
    automated match to d2oipa1
    complexed with cb3, dhf, ndp, ump; mutant

Details for d3dl5b1

PDB Entry: 3dl5 (more details), 2.74 Å

PDB Description: crystal structure of the a287f active site mutant of ts-dhfr from cryptosporidium hominis
PDB Compounds: (B:) Dihydrofolate reductase, DHFR

SCOPe Domain Sequences for d3dl5b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dl5b1 c.71.1.0 (B:3-180) automated matches {Cryptosporidium hominis [TaxId: 237895]}
eknvsivvaasvlssgigingqlpwsisedlkffskitnnkcdsnkknalimgrktwdsi
grrplknriivvissslpqdeadpnvvvfrnledsienlmnddsienifvcggesiyrda
lkdnfvdriyltrvalediefdtyfpeipetflpvymsqtfctknisydfmifekqek

SCOPe Domain Coordinates for d3dl5b1:

Click to download the PDB-style file with coordinates for d3dl5b1.
(The format of our PDB-style files is described here.)

Timeline for d3dl5b1: