Lineage for d3dl5e1 (3dl5 E:3-180)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1618271Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest
  4. 1618272Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) (S)
  5. 1618684Family c.71.1.0: automated matches [191485] (1 protein)
    not a true family
  6. 1618685Protein automated matches [190777] (17 species)
    not a true protein
  7. 1618807Species Cryptosporidium hominis [TaxId:237895] [231999] (4 PDB entries)
  8. 1618812Domain d3dl5e1: 3dl5 E:3-180 [232004]
    Other proteins in same PDB: d3dl5b2, d3dl5c2, d3dl5d2
    automated match to d2oipa1
    complexed with cb3, dhf, ndp, ump; mutant

Details for d3dl5e1

PDB Entry: 3dl5 (more details), 2.74 Å

PDB Description: crystal structure of the a287f active site mutant of ts-dhfr from cryptosporidium hominis
PDB Compounds: (E:) Dihydrofolate reductase, DHFR

SCOPe Domain Sequences for d3dl5e1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dl5e1 c.71.1.0 (E:3-180) automated matches {Cryptosporidium hominis [TaxId: 237895]}
eknvsivvaasvlssgigingqlpwsisedlkffskitnnkcdsnkknalimgrktwdsi
grrplknriivvissslpqdeadpnvvvfrnledsienlmnddsienifvcggesiyrda
lkdnfvdriyltrvalediefdtyfpeipetflpvymsqtfctknisydfmifekqek

SCOPe Domain Coordinates for d3dl5e1:

Click to download the PDB-style file with coordinates for d3dl5e1.
(The format of our PDB-style files is described here.)

Timeline for d3dl5e1: