| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest |
Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) ![]() |
| Family c.71.1.0: automated matches [191485] (1 protein) not a true family |
| Protein automated matches [190777] (16 species) not a true protein |
| Domain d3dl5e1: 3dl5 E:3-180 [232004] Other proteins in same PDB: d3dl5b2, d3dl5c2, d3dl5d2 automated match to d2oipa1 |
PDB Entry: 3dl5 (more details), 2.74 Å
SCOPe Domain Sequences for d3dl5e1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3dl5e1 c.71.1.0 (E:3-180) automated matches {Cryptosporidium hominis [TaxId: 237895]}
eknvsivvaasvlssgigingqlpwsisedlkffskitnnkcdsnkknalimgrktwdsi
grrplknriivvissslpqdeadpnvvvfrnledsienlmnddsienifvcggesiyrda
lkdnfvdriyltrvalediefdtyfpeipetflpvymsqtfctknisydfmifekqek
Timeline for d3dl5e1: