Class b: All beta proteins [48724] (178 folds) |
Fold b.21: Virus attachment protein globular domain [49834] (1 superfamily) sandwich, 10 strands in 2 sheets; greek-key |
Superfamily b.21.1: Virus attachment protein globular domain [49835] (4 families) |
Family b.21.1.0: automated matches [191353] (1 protein) not a true family |
Protein automated matches [190378] (9 species) not a true protein |
Species Lactococcus phage [TaxId:35345] [231976] (1 PDB entry) |
Domain d3da0b2: 3da0 B:63-165 [231980] Other proteins in same PDB: d3da0a1, d3da0b1, d3da0b3, d3da0c1 automated match to d2f0ca1 |
PDB Entry: 3da0 (more details), 1.65 Å
SCOPe Domain Sequences for d3da0b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3da0b2 b.21.1.0 (B:63-165) automated matches {Lactococcus phage [TaxId: 35345]} pvqtltveagnglqlqltkknndlvivrffgsvsniqkgwnmsgtwvdrpfrpaavqslv ghfagrdtsfhidinpngsitwwganidktpiatrgngsyfik
Timeline for d3da0b2:
View in 3D Domains from other chains: (mouse over for more information) d3da0a1, d3da0a2, d3da0c1, d3da0c2 |