Lineage for d3da0b2 (3da0 B:63-165)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2776827Fold b.21: Virus attachment protein globular domain [49834] (1 superfamily)
    sandwich, 10 strands in 2 sheets; greek-key
  4. 2776828Superfamily b.21.1: Virus attachment protein globular domain [49835] (4 families) (S)
  5. 2777097Family b.21.1.0: automated matches [191353] (1 protein)
    not a true family
  6. 2777098Protein automated matches [190378] (9 species)
    not a true protein
  7. 2777167Species Lactococcus phage [TaxId:35345] [231976] (1 PDB entry)
  8. 2777169Domain d3da0b2: 3da0 B:63-165 [231980]
    Other proteins in same PDB: d3da0a1, d3da0b1, d3da0b3, d3da0c1
    automated match to d2f0ca1

Details for d3da0b2

PDB Entry: 3da0 (more details), 1.65 Å

PDB Description: crystal structure of a cleaved form of a chimeric receptor binding protein from lactococcal phages subspecies tp901-1 and p2
PDB Compounds: (B:) Cleaved chimeric receptor binding protein from bacteriophages TP901-1 and p2

SCOPe Domain Sequences for d3da0b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3da0b2 b.21.1.0 (B:63-165) automated matches {Lactococcus phage [TaxId: 35345]}
pvqtltveagnglqlqltkknndlvivrffgsvsniqkgwnmsgtwvdrpfrpaavqslv
ghfagrdtsfhidinpngsitwwganidktpiatrgngsyfik

SCOPe Domain Coordinates for d3da0b2:

Click to download the PDB-style file with coordinates for d3da0b2.
(The format of our PDB-style files is described here.)

Timeline for d3da0b2: