![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families) ![]() C-terminal domain is beta/alpha barrel |
![]() | Family d.58.9.0: automated matches [227234] (1 protein) not a true family |
![]() | Protein automated matches [226983] (27 species) not a true protein |
![]() | Species Bacillus subtilis [TaxId:1423] [231734] (1 PDB entry) |
![]() | Domain d2zvid1: 2zvi D:12-123 [231739] Other proteins in same PDB: d2zvia2, d2zvia3, d2zvib2, d2zvib3, d2zvic2, d2zvic3, d2zvid2, d2zvid3 automated match to d4nasa1 |
PDB Entry: 2zvi (more details), 2.3 Å
SCOPe Domain Sequences for d2zvid1:
Sequence, based on SEQRES records: (download)
>d2zvid1 d.58.9.0 (D:12-123) automated matches {Bacillus subtilis [TaxId: 1423]} ellatylltepgadtekkaeqiatgltvgswtdlplvkqeqmqkhkgrvikveeregtaa sekqavitiaypeinfsqdipallttvfgklsldgkiklidlhfseafkral
>d2zvid1 d.58.9.0 (D:12-123) automated matches {Bacillus subtilis [TaxId: 1423]} ellatylltepgadtekkaeqiatgplvkqeqmqkhkgrvikveerekqavitiaypein fsqdipallttvfgklsldgkiklidlhfseafkral
Timeline for d2zvid1: