Lineage for d2zvib2 (2zvi B:124-411)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2838499Superfamily c.1.14: RuBisCo, C-terminal domain [51649] (2 families) (S)
    automatically mapped to Pfam PF00016
  5. 2838971Family c.1.14.0: automated matches [227297] (1 protein)
    not a true family
  6. 2838972Protein automated matches [227123] (9 species)
    not a true protein
  7. 2838981Species Bacillus subtilis [TaxId:1423] [231736] (1 PDB entry)
  8. 2838983Domain d2zvib2: 2zvi B:124-411 [231737]
    Other proteins in same PDB: d2zvia1, d2zvia3, d2zvib1, d2zvib3, d2zvic1, d2zvic3, d2zvid1, d2zvid3
    automated match to d4nasa2

Details for d2zvib2

PDB Entry: 2zvi (more details), 2.3 Å

PDB Description: Crystal structure of 2,3-diketo-5-methylthiopentyl-1-phosphate enolase from Bacillus subtilis
PDB Compounds: (B:) 2,3-diketo-5-methylthiopentyl-1-phosphate enolase

SCOPe Domain Sequences for d2zvib2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zvib2 c.1.14.0 (B:124-411) automated matches {Bacillus subtilis [TaxId: 1423]}
pgpkfgvygirkllgeferpllmsifkgvigrdlsdikeqlrqqalggvdlikddeiffe
tglapfetriaegkqilketyeqtghktlyavnltgrtadlkdkarraaelgadallfnv
faygldvmqglaedpeipvpimahpavsgaftsspfygfshalllgklnrycgadfslfp
spygsvalpradalaiheecvredafnqtfavpsagihpgmvpllmrdfgidhiinaggg
vhghpngaqgggrafraiidavleaqpidekaeqckdlklaldkwgka

SCOPe Domain Coordinates for d2zvib2:

Click to download the PDB-style file with coordinates for d2zvib2.
(The format of our PDB-style files is described here.)

Timeline for d2zvib2: