Lineage for d2yfhf2 (2yfh F:196-448)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845793Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2845794Protein automated matches [190069] (319 species)
    not a true protein
  7. 2846603Species Clostridium symbiosum [TaxId:1512] [231640] (1 PDB entry)
  8. 2846609Domain d2yfhf2: 2yfh F:196-448 [231642]
    Other proteins in same PDB: d2yfha1, d2yfhb1, d2yfhc1, d2yfhd1, d2yfhe1, d2yfhf1
    automated match to d1bgva1

Details for d2yfhf2

PDB Entry: 2yfh (more details), 2.7 Å

PDB Description: structure of a chimeric glutamate dehydrogenase
PDB Compounds: (F:) glutamate dehydrogenase, nad-specific glutamate dehydrogenase, glutamate dehydrogenase

SCOPe Domain Sequences for d2yfhf2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yfhf2 c.2.1.0 (F:196-448) automated matches {Clostridium symbiosum [TaxId: 1512]}
karsfggslirpeatgyglvyfteamlkrhgmgfegmrvsvsgsgnvaqyaiekamefga
rvitasdssgtvvdesgftkeklarlieikasrdgrvadyakefglvylegqqpwslpvd
ialpcatqneldvdaahqliangvkavaeganmpttieatelfqqagvlfapgkaanagg
vatsglemaqnaarlgwkaekvdarlhhimtdihdgsaaaaeryglgynlvaganivgfq
kiadammaqgiaw

SCOPe Domain Coordinates for d2yfhf2:

Click to download the PDB-style file with coordinates for d2yfhf2.
(The format of our PDB-style files is described here.)

Timeline for d2yfhf2: