Lineage for d2yfhf1 (2yfh F:2-195)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2890282Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
    core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134
  4. 2890283Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families) (S)
  5. 2890284Family c.58.1.1: Aminoacid dehydrogenases [53224] (4 proteins)
    dimerisation domain; contains additional structures including two extra N-terminal strands in the beta-sheet
  6. 2890410Protein automated matches [227004] (3 species)
    not a true protein
  7. 2890411Species Clostridium symbiosum [TaxId:1512] [231613] (1 PDB entry)
  8. 2890417Domain d2yfhf1: 2yfh F:2-195 [231619]
    Other proteins in same PDB: d2yfha2, d2yfhb2, d2yfhc2, d2yfhd2, d2yfhe2, d2yfhf2
    automated match to d1bgva2

Details for d2yfhf1

PDB Entry: 2yfh (more details), 2.7 Å

PDB Description: structure of a chimeric glutamate dehydrogenase
PDB Compounds: (F:) glutamate dehydrogenase, nad-specific glutamate dehydrogenase, glutamate dehydrogenase

SCOPe Domain Sequences for d2yfhf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yfhf1 c.58.1.1 (F:2-195) automated matches {Clostridium symbiosum [TaxId: 1512]}
skyvdrviaevekkyadepefvqtveevlsslgpvvdahpeyeevallermvipervief
rvpweddngkvhvntgyrvqfngaigpykgglrfapsvnlsimkflgfeqafkdslttlp
mggakggsdfdpngksdrevmrfcqafmtelyrhigpdidvpagdlgvgareigymygqy
rkivggfyngvltg

SCOPe Domain Coordinates for d2yfhf1:

Click to download the PDB-style file with coordinates for d2yfhf1.
(The format of our PDB-style files is described here.)

Timeline for d2yfhf1: