Class b: All beta proteins [48724] (176 folds) |
Fold b.61: Streptavidin-like [50875] (8 superfamilies) barrel, closed; n=8, S=10; meander |
Superfamily b.61.1: Avidin/streptavidin [50876] (2 families) |
Family b.61.1.0: automated matches [191402] (1 protein) not a true family |
Protein automated matches [190537] (7 species) not a true protein |
Species Bradyrhizobium japonicum [TaxId:375] [228284] (2 PDB entries) |
Domain d2y32b_: 2y32 B: [231592] automated match to d4bbod_ |
PDB Entry: 2y32 (more details), 1.78 Å
SCOPe Domain Sequences for d2y32b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2y32b_ b.61.1.0 (B:) automated matches {Bradyrhizobium japonicum [TaxId: 375]} qsvnwtwtnqygstlaitsfnsntgaitgtytnnaanscdegkpqgvtgwlaygntgtai sfsvnflgcgsttvwtgqlnnatgfqglwylslaeavawngisagadtftfssgdkallt ksgvdlkagseklsntk
Timeline for d2y32b_: