SCOPe 2.05: Domain d2y32b_: 2y32 B:

Lineage for d2y32b_ (2y32 B:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.61: Streptavidin-like [50875] (8 superfamilies)
   barrel, closed; n=8, S=10; meander

4. Superfamily b.61.1: Avidin/streptavidin [50876] (2 families)

5. Family b.61.1.0: automated matches [191402] (1 protein)
   not a true family

6. Protein automated matches [190537] (8 species)
   not a true protein

7. Species Bradyrhizobium japonicum [TaxId:375] [228284] (2 PDB entries)

8. Domain d2y32b_: 2y32 B: [231592]
   automated match to d4bbod_

Details for d2y32b_

PDB Entry: 2y32, 1.78 Å

PDB Description: crystal structure of bradavidin

PDB Compounds: (B:) blr5658 protein

SCOPe Domain Sequences for d2y32b_:

Sequence; same for both SEQRES and ATOM records:

>d2y32b_ b.61.1.0 (B:) automated matches {Bradyrhizobium japonicum [TaxId: 375]}
qsvnwtwtnqygstlaitsfnsntgaitgtytnnaanscdegkpqgvtgwlaygntgtai
sfsvnflgcgsttvwtgqlnnatgfqglwylslaeavawngisagadtftfssgdkallt
ksgvdlkagseklsntk

Timeline for d2y32b_:

• d2y32b_ first appeared in SCOPe 2.03
  
• d2y32b_ appears in SCOPe 2.04
  
• d2y32b_ appears in SCOPe 2.06
  
• d2y32b_ appears in the current release, SCOPe 2.08