| Class b: All beta proteins [48724] (177 folds) |
| Fold b.33: ISP domain [50021] (1 superfamily) consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8) |
Superfamily b.33.1: ISP domain [50022] (4 families) ![]() |
| Family b.33.1.0: automated matches [191455] (1 protein) not a true family |
| Protein automated matches [190701] (11 species) not a true protein |
| Species Burkholderia xenovorans [TaxId:266265] [226023] (9 PDB entries) |
| Domain d2xshe1: 2xsh E:18-179 [231579] Other proteins in same PDB: d2xsha2, d2xshb_, d2xshc2, d2xshd_, d2xshe2, d2xshf_, d2xshg2, d2xshh_, d2xshi2, d2xshj_, d2xshk2, d2xshl_ automated match to d2xr8c1 complexed with dc5, fe2, fes |
PDB Entry: 2xsh (more details), 2.29 Å
SCOPe Domain Sequences for d2xshe1:
Sequence, based on SEQRES records: (download)
>d2xshe1 b.33.1.0 (E:18-179) automated matches {Burkholderia xenovorans [TaxId: 266265]}
nwtpeairglvdqekglldpriyadqslyelelervfgrswlllgheshvpetgdflaty
mgedpvvmvrqkdksikvflnqcrhrgmricrsdagnakaftcsyhgwaydiagklvnvp
fekeafcdkkegdcgfdkaewgplqarvatykglvfanwdvq
>d2xshe1 b.33.1.0 (E:18-179) automated matches {Burkholderia xenovorans [TaxId: 266265]}
nwtpeairglvdqekglldpriyadqslyelelervfgrswlllgheshvpetgdflaty
mgedpvvmvrqkdksikvflnqcrhrgmricrsdagnakaftcsyhgwaydiagklvnvp
fekeaffdkaewgplqarvatykglvfanwdvq
Timeline for d2xshe1: