Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
Superfamily d.17.4: NTF2-like [54427] (31 families) has a beta-alpha(2)-beta insertion after the main helix |
Family d.17.4.4: Ring hydroxylating beta subunit [54438] (7 proteins) Pfam PF00866 |
Protein automated matches [190223] (5 species) not a true protein |
Species Burkholderia xenovorans [TaxId:266265] [189543] (9 PDB entries) |
Domain d2xshd_: 2xsh D: [170353] Other proteins in same PDB: d2xsha1, d2xsha2, d2xshc1, d2xshc2, d2xshe1, d2xshe2, d2xshg1, d2xshg2, d2xshi1, d2xshi2, d2xshk1, d2xshk2 automated match to d1wqlb1 complexed with dc5, fe2, fes |
PDB Entry: 2xsh (more details), 2.29 Å
SCOPe Domain Sequences for d2xshd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2xshd_ d.17.4.4 (D:) automated matches {Burkholderia xenovorans [TaxId: 266265]} fktfewpskaaglelqneieqfyyreaqlldhrayeawfalldkdihyfmplrtnrmire geleysgdqdlahfdethetmygrirkvtsdvgwaenppsrtrhlvsnvivketatpdtf evnsafilyrnrlerqvdifagerrdvlrradnnlgfsiakrtilldastllsnnlsmff
Timeline for d2xshd_: