SCOPe 2.08: Domain d2x2yb2: 2x2y B:371-464

Lineage for d2x2yb2 (2x2y B:371-464)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (27 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.0: automated matches [191341] (1 protein)
   not a true family

6. Protein automated matches [190226] (81 species)
   not a true protein

7. Species Cellulomonas fimi [TaxId:1708] [231539] (1 PDB entry)

8. Domain d2x2yb2: 2x2y B:371-464 [231542]
   Other proteins in same PDB: d2x2ya1, d2x2ya3, d2x2yb1, d2x2yb3
   automated match to d2bvta1
   complexed with fmt, mg; mutant

Details for d2x2yb2

PDB Entry: 2x2y, 2.35 Å

PDB Description: cellulomonas fimi endo-beta-1,4-mannanase double mutant

PDB Compounds: (B:) man26a

SCOPe Domain Sequences for d2x2yb2:

Sequence, based on SEQRES records:

>d2x2yb2 b.1.18.0 (B:371-464) automated matches {Cellulomonas fimi [TaxId: 1708]}
aqpvvhiaspadgarvasapttvrvrvggtdvqsvtvevaqggtvvdtldlaydgalwwt
apwsptsaqldnstytvtatattaagtldvtnev

Sequence, based on observed residues (ATOM records):

>d2x2yb2 b.1.18.0 (B:371-464) automated matches {Cellulomonas fimi [TaxId: 1708]}
aqpvvhiaspadgarvasapttvrvrvggtdvqsvtvevaqtvvdtldlaydgalwwtap
wspytvtatattaagtldvtnev

Timeline for d2x2yb2:

• d2x2yb2 first appeared in SCOPe 2.03
  
• d2x2yb2 appears in SCOPe 2.07