Lineage for d2x2yb2 (2x2y B:371-464)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2765063Superfamily b.1.18: E set domains [81296] (27 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2766140Family b.1.18.0: automated matches [191341] (1 protein)
    not a true family
  6. 2766141Protein automated matches [190226] (81 species)
    not a true protein
  7. 2766176Species Cellulomonas fimi [TaxId:1708] [231539] (1 PDB entry)
  8. 2766178Domain d2x2yb2: 2x2y B:371-464 [231542]
    Other proteins in same PDB: d2x2ya1, d2x2ya3, d2x2yb1, d2x2yb3
    automated match to d2bvta1
    complexed with fmt, mg; mutant

Details for d2x2yb2

PDB Entry: 2x2y (more details), 2.35 Å

PDB Description: cellulomonas fimi endo-beta-1,4-mannanase double mutant
PDB Compounds: (B:) man26a

SCOPe Domain Sequences for d2x2yb2:

Sequence, based on SEQRES records: (download)

>d2x2yb2 b.1.18.0 (B:371-464) automated matches {Cellulomonas fimi [TaxId: 1708]}
aqpvvhiaspadgarvasapttvrvrvggtdvqsvtvevaqggtvvdtldlaydgalwwt
apwsptsaqldnstytvtatattaagtldvtnev

Sequence, based on observed residues (ATOM records): (download)

>d2x2yb2 b.1.18.0 (B:371-464) automated matches {Cellulomonas fimi [TaxId: 1708]}
aqpvvhiaspadgarvasapttvrvrvggtdvqsvtvevaqtvvdtldlaydgalwwtap
wspytvtatattaagtldvtnev

SCOPe Domain Coordinates for d2x2yb2:

Click to download the PDB-style file with coordinates for d2x2yb2.
(The format of our PDB-style files is described here.)

Timeline for d2x2yb2: